The domain within your query sequence starts at position 394 and ends at position 617; the E-value for the ATP-sulfurylase domain shown below is 7.8e-74.
DQYRLTPTELKQKFKDMNADAVFAFQLRNPVHNGHALLMQDTHKQLLERGYRRPVLLLHP LGGWTKDDDVPLMWRMKQHAAVLEEGILDPETTVVAIFPSPMMYAGPTEVQWHCRARMVA GANFYIVGRDPAGMPHPETGKDLYEPTHGAKVLTMAPGLITLEIVPFRVAAYNKKKKRMD YYDSEHHEDFEFISGTRMRKLAREGQKPPEGFMAPKAWTVLVEY
ATP-sulfurylase |
---|
PFAM accession number: | PF01747 |
---|---|
Interpro abstract (IPR024951): | This domain is the catalytic domain of ATP-sulfurylase or sulphate adenylyltransferase ( EC 2.7.7.4 ). ATP-sulfurylase catalyses the synthesis of adenosine-phosphosulphate (APS) from ATP and inorganic sulphate [ (PUBMED:9671738) ]. Sometimes is found as part of a bifunctional polypeptide chain associated with adenylylsulphate kinase ( IPR002891 ). Both enzymes are required for PAPS (phosphoadenosine-phosphosulphate) synthesis from inorganic sulphate [ (PUBMED:8522184) ]. |
GO function: | sulfate adenylyltransferase (ATP) activity (GO:0004781) |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry ATP-sulfurylase