The domain within your query sequence starts at position 14 and ends at position 117; the E-value for the ATP_bind_1 domain shown below is 9.2e-42.
VIGPPGSGKTTYCLGMSEFLRALGRRVAVVNLDPANDGLPYECAVDVGELVGLGDVMDAL RLGPNGGLLYCMEYLEANLDWLRAKLEPLRGHYFLFDCPGQLTA
ATP_bind_1 |
---|
PFAM accession number: | PF03029 |
---|---|
Interpro abstract (IPR004130): | Proteins in this entry belong to the GPN-loop GTPase family [ (PUBMED:17468740) ], including Npa3 (also known as Gpn1) and Gpn2/3 from budding yeasts. In humans, Npa3 homologue is known as XAB1; Gpn2 is known as GPN2/ATPBD1B; Gpn3 is known as Parcs. Npa3 plays an important part in transporting RNA polymerase II (RNAPII) to the nucleus. The binding of Npa3 with RNAPII is GTP-dependent [ (PUBMED:21844196) ]. Gpn2 and Gpn3 are putative GTPase that have a role in biogenesis of RNA polymerase II and III [ (PUBMED:23267056) ]. Npa3, Gpn2 and Gpn3 is involved in sister chromatid cohesion [ (PUBMED:21532343) (PUBMED:23324351) ]. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry ATP_bind_1