The domain within your query sequence starts at position 1 and ends at position 176; the E-value for the A_deamin domain shown below is 1.3e-49.
XLGVQGALLSHFIQPVYISSILVGDGNCNDTRGLEIAINQRVDDALTSKLPMFYLVNRPH ISLVPTAYPLQINLDHKSLSLNWAQGDNSLEIVDGLNGKITESSPFKSGLSMASRLCKAA MLSRFNLLAKEAKTDDLLEARTYHAAKCMSGPYQEAKALLKAYLQQHGYGSWIVKS
A_deamin |
![]() |
---|
PFAM accession number: | PF02137 |
---|---|
Interpro abstract (IPR002466): | Editase ( EC 3.5 ) are enzymes that alter mRNA by catalyzing the site-selective deamination of adenosine residue into inosine residue. The editase domain contains the active site and binds three Zn atoms [ (PUBMED:9159072) ]. Several editases share a common global arrangement of domains, from N to C terminus: two 'double-stranded RNA-specific adenosine deaminase' (DRADA) repeat domains ( IPR000607 ), followed by three 'double-stranded RNA binding' (DsRBD) domains, followed by the editase domain. Other editases have a simplified domains structure with no DRADA_REP and possibly fewer DSRBD domains. Editase that deaminate cytidine are not detected by this signature. |
GO process: | RNA processing (GO:0006396) |
GO function: | RNA binding (GO:0003723), adenosine deaminase activity (GO:0004000) |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry A_deamin