The domain within your query sequence starts at position 303 and ends at position 535; the E-value for the Aa_trans domain shown below is 2.5e-45.
AGPLHSNGVEYEAQGAEKCQPKYFVFNSRTAYAIPILAFAFVCHPEVLPIYSELKDRSRR KMQTVSNISISGMLVMYLLAALFGYLSFYGDVEDELLHAYSKVYTFDTALLMVRLAVLVA VTLTVPIVLFPIRTSVITLLFPRKPFSWLKHFGIAAIIIALNNILVILVPTIKYIFGFIG ASSATMLIFILPAAFYLKLVKKEPLRSPQKIGALVFLVTGIIFMMGSMALIIL
Aa_trans |
![]() |
---|
PFAM accession number: | PF01490 |
---|---|
Interpro abstract (IPR013057): | This transmembrane domain is found in many amino acid transporters including P34579 (UNC-47) and P40501 (MTR). UNC-47 encodes a vesicular amino butyric acid (GABA) transporter, (VGAT) and is is predicted to have 10 transmembrane domains UNC47_CAEEL [ (PUBMED:9349821) ]. MTR is an N system amino acid transporter system protein involved in methyltryptophan resistance MTR_NEUCR. Other proteins with this domain include proline transporters and amino acid transporters whose specificity has not yet been identified. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry Aa_trans