The domain within your query sequence starts at position 1230 and ends at position 1350; the E-value for the AbfB domain shown below is 1.2e-10.
VFSLPRSNNRGNLFFIFMITPGLFKEKTSSLALVSLESAERPNYFLYVHDNDTLSLKLWR ANSEFHQRATFFHHQGLWIPGYSAFELYSKKGYFIVFMGSSVKASKYDDSEEFKQSSSFS I
AbfB |
![]() |
---|
PFAM accession number: | PF05270 |
---|---|
Interpro abstract (IPR007934): | Alpha-L-arabinofuranosidase B (AkAbfB) comprises two domains: a catalytic domain and an arabinose-binding domain (ABD). This entry represents the ABD domain. ABD has a beta-trefoil fold similar to that of carbohydrate-binding module (CBM) family 13 but also with a number of distinctive characteristics, suggesting that it could be classified into a new CBM family [ (PUBMED:15292273) ]. |
GO process: | L-arabinose metabolic process (GO:0046373) |
GO function: | alpha-L-arabinofuranosidase activity (GO:0046556) |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry AbfB