The domain within your query sequence starts at position 38 and ends at position 100; the E-value for the Abhydro_lipase domain shown below is 1.4e-22.
ASEIIMYNGYPSEEYDVTTADGYILAINRIPHGRAQTGQTGPRPVVYMQHALFADNAYWL ENF
Abhydro_lipase |
 |
|---|
| PFAM accession number: | PF04083 |
|---|---|
| Interpro abstract (IPR006693): | The alpha/beta hydrolase fold is common to several hydrolytic enzymes of widely differing phylogenetic origin and catalytic function. The core of each enzyme is similar: an alpha/beta sheet, not barrel, of eight beta-sheets connected by alpha-helices [ (PUBMED:1409539) ]. This entry represents the N-terminal part of an alpha/beta hydrolase domain found in a number of lipases. |
| GO process: | lipid metabolic process (GO:0006629) |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry Abhydro_lipase