The domain within your query sequence starts at position 60 and ends at position 225; the E-value for the Abhydrolase_2 domain shown below is 2.4e-9.
DSGPCSPEEQPRGWWFSEEEADVFSALEESTVCRGLQEALETVARALDTLGPFDGLLGFS QGAALAAYVCALGQAGDPRFPLPRFIILVSGFCPRGLKEPILQSPMSLPSLHVFGDTDRV IPSQESMQLASRFLGAVTLTHSGGHFIPAAASQRQAYLKFLDQFAE
Abhydrolase_2 |
---|
PFAM accession number: | PF02230 |
---|---|
Interpro abstract (IPR003140): | This entry represents the alpha/beta hydrolase domain found in phospholipases [ (PUBMED:9644627) ], carboxylesterases [ (PUBMED:9438866) ] and thioesterases. |
GO function: | hydrolase activity (GO:0016787) |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry Abhydrolase_2