The domain within your query sequence starts at position 74 and ends at position 290; the E-value for the Acatn domain shown below is 6e-61.
SILLLLFLYVLQGIPLGLAGSIPLILQSKNVSYTDQAFFSFVFWPFSLKLLWAPLVDAVY FKNFGRRKSWLVPTQYTLGIFMIYLSTQVDRLLGNIDGRTPDVVALTVTFFLFEFLAATQ DIAVDGWALTMLSRENVGYASTCNSVGQTAGYFLGNVLFLALESADFCNKYLRFQPQPRG IVTLSDFLFFWGTVFLITTTLVALLKKENREASIVKE
Acatn |
![]() |
---|
PFAM accession number: | PF13000 |
---|---|
Interpro abstract (IPR024371): | Acetyl-coenzyme A transporter 1 (also known as acatn) is a multipass transmembrane protein that appears to promote 9-O-acetylation in gangliosides [ (PUBMED:10570973) (PUBMED:9096318) ]. This entry represents acatn and its homologues. |
GO component: | integral component of membrane (GO:0016021) |
GO function: | acetyl-CoA transmembrane transporter activity (GO:0008521) |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry Acatn