The domain within your query sequence starts at position 180 and ends at position 253; the E-value for the Acyl_CoA_thio domain shown below is 2.8e-8.

AAQEVPIEIKVVNPPTLTQLQALEPKQMFWVRARGYIGEGDIKMHCCVAAYISDYAFLGT
ALLPHQSKYKVALE

Acyl_CoA_thio

• PFAM accession number: PF02551
• Interpro abstract (IPR025652):

  Escherichia coli thioesterase II reveals a new tertiary fold: a 'double hot dog'. It has an internal repeat with a basic unit that is structurally similar to the recently described beta-hydroxydecanoyl thiol ester dehydrase [ (PUBMED:10876240) ].

  This entry represents the thioesterase II domain. Two copies of this domain are found in a number of acyl-CoA thioesterases.

This is a PFAM domain. For full annotation and more information, please see the PFAM entry Acyl_CoA_thio