The domain within your query sequence starts at position 38 and ends at position 132; the E-value for the Acyl_CoA_thio domain shown below is 4.6e-9.
DEDLYRGRHYWVPTSQRLFGGQIMGQALVAAAKSVSEDVHVHSLHCYFVRAGDPKVPVLY HVERIRTGASFSVRAVKAVQHGKAIFICQASFQQM
Acyl_CoA_thio |
![]() |
---|
PFAM accession number: | PF02551 |
---|---|
Interpro abstract (IPR025652): | Escherichia coli thioesterase II reveals a new tertiary fold: a 'double hot dog'. It has an internal repeat with a basic unit that is structurally similar to the recently described beta-hydroxydecanoyl thiol ester dehydrase [ (PUBMED:10876240) ]. This entry represents the thioesterase II domain. Two copies of this domain are found in a number of acyl-CoA thioesterases. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry Acyl_CoA_thio