The domain within your query sequence starts at position 108 and ends at position 232; the E-value for the Ada3 domain shown below is 6.7e-33.
VPHTKSLESRIKEELIAQGLLESEDRPAEDSEDEVLAELRKRQAELKALSAHNRTKKHDL LRLAKEEVSRQELRQRVRMADNEVMDAFRKIMAARQKKRTPTKKEKDQAWKTLKERESIL KLLDG
Ada3 |
---|
PFAM accession number: | PF10198 |
---|---|
Interpro abstract (IPR019340): | This entry is found in Ada3 and homologous proteins which function as part of histone acetyltransferase complexes [ (PUBMED:8413201) ]. Ada3 is an essential component of the Ada transcriptional coactivator (alteration/deficiency in activation) complex. It plays a key role in linking histone acetyltransferase-containing complexes to p53 (tumour suppressor protein) thereby regulating p53 acetylation, stability and transcriptional activation following DNA damage [ (PUBMED:17272277) ]. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry Ada3