The domain within your query sequence starts at position 110 and ends at position 220; the E-value for the Adhes-Ig_like domain shown below is 2.4e-57.
AFPDQLVVSPEFLVPGQDQVVSCTAHNIWPADPNSLSFALLLGEQRLEGAQALEPEQEEE IQEAEGTPLFRMTQRWRLPSLGTPAPPALHCQVTMQLPKLVLTHRKEIPVL
Adhes-Ig_like |
 |
|---|
| PFAM accession number: | PF09085 |
|---|---|
| Interpro abstract (IPR015169): | This domain is found in mucosal vascular addressin cell adhesion molecule 1 proteins (MAdCAM-1). These are cell adhesion molecules expressed on the endothelium in mucosa that guide the specific homing of lymphocytes into mucosal tissues. MAdCAM-1 belongs to a subclass of the immunoglobulin superfamily (IgSF), the members of which are ligands for integrins [ (PUBMED:9655832) ]. The crystal structure of this domain has been reported; it adopts an immunoglobulin-like beta-sandwich structure, with seven strands arranged in two beta-sheets in a Greek-key topology [ (PUBMED:11807247) (PUBMED:9655832) ]. |
| GO process: | cell adhesion (GO:0007155) |
| GO component: | membrane (GO:0016020) |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry Adhes-Ig_like