The domain within your query sequence starts at position 955 and ends at position 1095; the E-value for the Ago_hook domain shown below is 1.2e-28.
REPNLPTPMTGKSASVWSKSTPPAPDNGTSAWGEPNESSPGWGEMDDAGASTTGWGNTPA NAPNAMKPNSKSMQDGWGESDGPVTGARHPSWEEEDDGGVWNTAGSQGSTSSHNSASWGQ GGKKQMKCSLKGGNNDSWMNP
Ago_hook |
![]() |
---|
PFAM accession number: | PF10427 |
---|---|
Interpro abstract (IPR019486): | This entry represents a region called the argonaute hook [ (PUBMED:17891150) ]. It has been shown to bind to the Piwi domain ( IPR003165 ) of argnonaute proteins. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry Ago_hook