The domain within your query sequence starts at position 25 and ends at position 130; the E-value for the Alg14 domain shown below is 2.3e-25.
LLIVAGSGGHTTEILRLVGSLSNAYSPRHYVIAESDEMSAKKIHSLEELSRAQNDSTTEY PKYHLHRIPRSREVRQSWLSSVFTTFYSMWFSFPLVLRIKPDLVCK
Alg14 |
![]() |
---|
PFAM accession number: | PF08660 |
---|---|
Interpro abstract (IPR013969): | Alg14 is involved dolichol-linked oligosaccharide biosynthesis and anchors the catalytic subunit Alg13 to the ER membrane [ (PUBMED:16100110) ]. |
GO process: | dolichol-linked oligosaccharide biosynthetic process (GO:0006488) |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry Alg14