SMART: Pfam domain Alveol-reg

The domain within your query sequence starts at position 1 and ends at position 68; the E-value for the Alveol-reg_P311 domain shown below is 2.6e-41.

MVYYPELLVWVSQEPFAYKEMEGGLIKGRLPVPKEVNRKKMEETGAASLTPPGSREFTSP
ATSYLHPF

Alveol-reg_P311

PFAM accession number:	PF11092
Interpro abstract (IPR024417):	Neuronal protein 3.1, also known as P311, is found in neurone and muscle cells [ (PUBMED:16229809) ]. It contains a conserved PEST (Pro, Glu, Ser, and Thr) motif, which is involved in protein-protein interactions, as well as in targeting proteins for degradation by the ubiquitin/proteasome system. In addition to a potential role in neural function, P311 may be involved in regulating glioma motility [ (PUBMED:16229809) ] and could have some function in myo-fibroblast transformation and prevention of fibrosis [ (PUBMED:12417574) ]. It has also been identified as a potential regulator of alveolar generation [ (PUBMED:16484684) ].

PFAM accession number:

PF11092

Interpro abstract (IPR024417):

Neuronal protein 3.1, also known as P311, is found in neurone and muscle cells [ (PUBMED:16229809) ]. It contains a conserved PEST (Pro, Glu, Ser, and Thr) motif, which is involved in protein-protein interactions, as well as in targeting proteins for degradation by the ubiquitin/proteasome system.

In addition to a potential role in neural function, P311 may be involved in regulating glioma motility [ (PUBMED:16229809) ] and could have some function in myo-fibroblast transformation and prevention of fibrosis [ (PUBMED:12417574) ]. It has also been identified as a potential regulator of alveolar generation [ (PUBMED:16484684) ].

This is a PFAM domain. For full annotation and more information, please see the PFAM entry Alveol-reg_P311