The domain within your query sequence starts at position 17 and ends at position 211; the E-value for the Amelotin domain shown below is 2e-96.
LPKQLNPASGVPATKPTPGQVTPLPQQQPNQVFPSISLIPLTQLLTLGSDLPLFNPAAGP HGAHTLPFTLGPLNGQQQLQPQMLPIIVAQLGAQGALLSSEELPLASQIFTGLLIHPLFP GAIPPSGQAGTKPDVQNGVLPTRQAGAKAVNQGTTPGHVTTPGVTDDDDYEMSTPAGLRR ATHTTEGTTIDPPNR
Amelotin |
---|
PFAM accession number: | PF15757 |
---|---|
Interpro abstract (IPR031501): | Amelotin (AMTN) is specifically expressed during the maturation stage of dental enamel formation [ (PUBMED:16304441) ]. It plays a role in dental enamel formation by promoting hydroxyapatite mineralisation [ (PUBMED:25407797) ]. |
GO process: | odontogenesis of dentin-containing tooth (GO:0042475), positive regulation of enamel mineralization (GO:0070175) |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry Amelotin