The domain within your query sequence starts at position 797 and ends at position 950; the E-value for the Anillin domain shown below is 8.8e-39.
SKGSVTLSEICLPLKADFVCSTAQKTDASNYYYLIMLKAGAEQMVATPLASTANSLSGDA LTFPTTFTLHDVSNDFEINIEVYSLVQKKDSLGPDKKKKASKSKAITPKRLLTSITSKSS LHSSVMASPGGLGAVRTSNFTLVGSHTLSLSSVG
Anillin |
![]() |
---|
PFAM accession number: | PF08174 |
---|---|
Interpro abstract (IPR012966): | Anillin is a protein involved in septin organisation during cell division. It is an actin binding protein that is localised to the cleavage furrow, and it maintains the localisation of active myosin, which ensures the spatial control of concerted contraction during cytokinesis [ (PUBMED:16040610) ]. This entry represents a conserved domain found in anillin and anillin-like proteins. This domain shares homology with the RhoA binding protein Rhotekin [ (PUBMED:18158243) ]. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry Anillin