The domain within your query sequence starts at position 208 and ends at position 335; the E-value for the Anoctamin domain shown below is 3e-36.
VRKYFGEKVGLYFAWLGAYTQMLIPASIVGVIVFLYGCATVDENIPSMEMCDQRYNITMC PLCDKTCSYWKMSSACATARASHLFDNPATVFFSVFMALWAATFMEHWKRKQMRLNYRWD LTGFEEEE
Anoctamin |
---|
PFAM accession number: | PF04547 |
---|---|
Interpro abstract (IPR007632): | This entry represents the anoctamin family, which includes anoctamin1-10 (Ano1-10 or TMEM16A-J); 7 members could be divided into two subfamilies, Ca(2+)-dependent Cl(-) channels (TMEM16A and 16B) and Ca(2+)-dependent lipid scramblases (TMEM16C, 16D, 16F, 16G, and 16J) [ (PUBMED:23532839) ]. This entry also includes anoctamin-like protein At1g73020 from Arabidopsis and increased sodium tolerance protein 2 (Ist2) from budding yeasts. Ano1 and Ano2 (also known as TMEM16A and TMEM16B) are calcium-activated chloride channels (CaCC), which play a role in transepithelial anion transport and smooth muscle contraction [ (PUBMED:18724360) (PUBMED:19474308) ]. Ano3-10 do not exhibit calcium-activated chloride channel (CaCC) activity [ (PUBMED:17308099) (PUBMED:20056604) ]. Ist2 may be involved in ion homeostasis together with BTN1 or BTN2 [ (PUBMED:15701790) ]. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry Anoctamin