The domain within your query sequence starts at position 4401 and ends at position 4456; the E-value for the ApoB100_C domain shown below is 5.6e-34.
QFHSNLQDFSDQLSSYYEKFVGESTRLIDLSIQNYHVFLRYITELLRKLQVATANN
ApoB100_C |
![]() |
---|
PFAM accession number: | PF12491 |
---|---|
Interpro abstract (IPR022176): | This domain is found in the C terminus of some apolipoprotein B100 (ApoB100) proteins. It is approximately 60 amino acids in length and contains two conserved sequence motifs: QLS and LIDL. ApoB100 has an essential role in the assembly and secretion of triglyceride-rich lipoproteins and lipids transport [ (PUBMED:17934898) ]. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry ApoB100_C