The domain within your query sequence starts at position 4434 and ends at position 4490; the E-value for the ApoB100_C domain shown below is 1.6e-32.

QFHSNLQDFSDQLSSYYEKFVGESTRLIDLSIQNYHVFLRYITELLRKLQVATANNV

ApoB100_C

 ApoB100_C
PFAM accession number:PF12491
Interpro abstract (IPR022176):

This domain is found in the C terminus of some apolipoprotein B100 (ApoB100) proteins. It is approximately 60 amino acids in length and contains two conserved sequence motifs: QLS and LIDL. ApoB100 has an essential role in the assembly and secretion of triglyceride-rich lipoproteins and lipids transport [ (PUBMED:17934898) ].

This is a PFAM domain. For full annotation and more information, please see the PFAM entry ApoB100_C