The domain within your query sequence starts at position 1 and ends at position 189; the E-value for the ApoM domain shown below is 9.2e-99.
MFHQVWAALLSLYGLLFNSMNQCPEHSQLTALGMDDTETPEPHLGLWYFIAGAASTTEEL ATFDPVDNIVFNMAAGSAPRQLQLRATIRTKSGVCVPRKWTYRLTEGKGNMELRTEGRPD MKTDLFSSSCPGGIMLKETGQGYQRFLLYNRSPHPPEKCVEEFQSLTSCLDFKAFLVTPR NQEACPLSS
ApoM |
![]() |
---|
PFAM accession number: | PF11032 |
---|---|
Interpro abstract (IPR022734): | ApoM is a 25kDa plasma protein associated with high-density lipoproteins (HDLs). ApoM is important in the formation of pre-ss-HDL and also in increasing cholesterol efflux from macrophage foam cells [ (PUBMED:18490703) ]. Lipoproteins consist of lipids solubilized by apolipoproteins. ApoM lacks an external amphipathic motif and is uniquely secreted to plasma without cleavage of its terminal signal peptide [ (PUBMED:18460466) ]. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry ApoM