SMART: Pfam domain Archease

The domain within your query sequence starts at position 31 and ends at position 167; the E-value for the Archease domain shown below is 3.3e-49.

YEYLDHTADVQLHAWGDTLEEAFEQCAMAMFGYMTDTGTVEPLRTVEVETQGDDLQSLLF
HFLDEWLYKFSADEYFIPREVKVLNIDQKNFKLRSIGWGEEFSLSKHPQGTEVKAITYSA
MQVYNEEKPEVFVIIDI

Archease

PFAM accession number:	PF01951
Interpro abstract (IPR023572):	The function of one of the archeases from the hyperthermophile Pyrococcus abyssi has been determined. The gene encoding the archease (PAB1946) is located in a bicistronic operon immediately upstream from a second open reading frame (PAB1947), which encodes a tRNA m5C methyltransferase. The methyl transferase catalyses m5C formation at several cytosine's within tRNAs with preference for C49; the specificity of the methyltransferase reaction being increased by the archease. The archease protects the tRNA (cytosine-5-)-methyltransferase PAB1947 against aggregation and increases its specificity. The archease exists in monomeric and oligomeric states, with only the oligomeric forms able to bind the methyltransferase [ (PUBMED:17470432) ]. The function of this family of archeases as chaperones is supported by structural analysis of O27635 from Methanobacterium thermoautotrophicum, which shows homology to heat shock protein 33, which is a chaperone protein that inhibits the aggregation of partially denatured proteins [ (PUBMED:11854485) ]. The archease superfamily of proteins are represented in all three domains of life. Archease genes are generally located adjacent to genes encoding proteins involved in DNA or RNA processing and therefore have been predicted to be modulators or chaperones involved in DNA or RNA metabolism. Many of the roles of archeases remain to be established experimentally. Structurally, the archeases are composed of a single three layer beta-alpha-beta sandwich domain similar to those found in other chaperones.

PFAM accession number:

PF01951

Interpro abstract (IPR023572):

The function of one of the archeases from the hyperthermophile Pyrococcus abyssi has been determined. The gene encoding the archease (PAB1946) is located in a bicistronic operon immediately upstream from a second open reading frame (PAB1947), which encodes a tRNA m5C methyltransferase. The methyl transferase catalyses m5C formation at several cytosine's within tRNAs with preference for C49; the specificity of the methyltransferase reaction being increased by the archease. The archease protects the tRNA (cytosine-5-)-methyltransferase PAB1947 against aggregation and increases its specificity. The archease exists in monomeric and oligomeric states, with only the oligomeric forms able to bind the methyltransferase [ (PUBMED:17470432) ].

The function of this family of archeases as chaperones is supported by structural analysis of O27635 from Methanobacterium thermoautotrophicum, which shows homology to heat shock protein 33, which is a chaperone protein that inhibits the aggregation of partially denatured proteins [ (PUBMED:11854485) ].

The archease superfamily of proteins are represented in all three domains of life. Archease genes are generally located adjacent to genes encoding proteins involved in DNA or RNA processing and therefore have been predicted to be modulators or chaperones involved in DNA or RNA metabolism. Many of the roles of archeases remain to be established experimentally.

Structurally, the archeases are composed of a single three layer beta-alpha-beta sandwich domain similar to those found in other chaperones.

This is a PFAM domain. For full annotation and more information, please see the PFAM entry Archease