The domain within your query sequence starts at position 373 and ends at position 418; the E-value for the ArgoL2 domain shown below is 3.6e-18.
RQEEISRLMKNASYNLDPYIQEFGIKVKDDMTEVTGRVLPAPILQY
ArgoL2 |
---|
PFAM accession number: | PF16488 |
---|---|
Interpro abstract (IPR032472): | ArgoL2 is the second linker domain in eukaryotic argonaute proteins. It starts with two alpha-helices aligned orthogonally to each other followed by a beta-strand involved in linking the two lobes, the PAZ lobe and the Piwi lobe of argonaute to each other. Linker 2 together with the N, PAZ and L1 domains form a compact global fold [ (PUBMED:16061186) ]. Numerous residues from Piwi, L1 and L2 linkers direct the path of the phosphate backbone of nucleotides 7-9, thus allowing DNA-slicing [ (PUBMED:23746446) ]. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry ArgoL2