The domain within your query sequence starts at position 447 and ends at position 499; the E-value for the Arm_3 domain shown below is 5.4e-25.
STIAEIIEECGGLEKIEVLQQHENEDIYKLAFEIIDQYFSGDDIDEDPSLIPE
Arm_3 |
---|
PFAM accession number: | PF16186 |
---|---|
Interpro abstract (IPR032413): | This atypical Arm repeat appears at the very C terminus of eukaryotic proteins such as importin subunit alpha, as the last of the repeating units. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry Arm_3