The domain within your query sequence starts at position 458 and ends at position 509; the E-value for the Arm_3 domain shown below is 3.6e-27.

EKLSIMIEECGGLDKIEALQRHENESVYKASLNLIEKYFSVEEEEDQNVVPE

Arm_3

• PFAM accession number: PF16186
• Interpro abstract (IPR032413):

  This atypical Arm repeat appears at the very C terminus of eukaryotic proteins such as importin subunit alpha, as the last of the repeating units.

This is a PFAM domain. For full annotation and more information, please see the PFAM entry Arm_3