SMART: Pfam domain Armet

The domain within your query sequence starts at position 18 and ends at position 120; the E-value for the Armet domain shown below is 1.7e-44.

DCEVCISYLGRFYQDLKDRDVTFSPATIEEELIKFCREARGKENRLCYYIGATDDAATKI
INEVSKPLAHHIPVEKICEKLKKKDSQICELKYGLEPFLETIK

Armet

PFAM accession number:	PF10208
Interpro abstract (IPR019345):	This entry represents Armet proteins, also known as mesencephalic astrocyte-derived neurotrophic factor (MANF) or arginine-rich protein. Armet is a small protein of approximately 170 residues which contains four di-sulphide bridges that are highly conserved from nematodes to humans. Armet is a soluble protein resident in the endoplasmic reticulum and induced by ER stress. It appears to be involved with dealing with mis-folded proteins in the ER, thus in quality control of ER stress [ (PUBMED:17507765) ]. Armet from Rattus norvegicus (Rat) selectively promotes the survival of dopaminergic neurons of the ventral mid-brain. It modulates GABAergic transmission to the dopaminergic neurons of the substantia nigra, and enhances spontaneous, as well as evoked, GABAergic inhibitory postsynaptic currents in dopaminergic neurons [ (PUBMED:16462600) ]. This entry also includes the related neurotrophic factor CDNF (cerebral dopamine neurotrophic factor) [ (PUBMED:27425895) ].

PFAM accession number:

PF10208

Interpro abstract (IPR019345):

This entry represents Armet proteins, also known as mesencephalic astrocyte-derived neurotrophic factor (MANF) or arginine-rich protein. Armet is a small protein of approximately 170 residues which contains four di-sulphide bridges that are highly conserved from nematodes to humans. Armet is a soluble protein resident in the endoplasmic reticulum and induced by ER stress. It appears to be involved with dealing with mis-folded proteins in the ER, thus in quality control of ER stress [ (PUBMED:17507765) ]. Armet from Rattus norvegicus (Rat) selectively promotes the survival of dopaminergic neurons of the ventral mid-brain. It modulates GABAergic transmission to the dopaminergic neurons of the substantia nigra, and enhances spontaneous, as well as evoked, GABAergic inhibitory postsynaptic currents in dopaminergic neurons [ (PUBMED:16462600) ].

This entry also includes the related neurotrophic factor CDNF (cerebral dopamine neurotrophic factor) [ (PUBMED:27425895) ].

This is a PFAM domain. For full annotation and more information, please see the PFAM entry Armet