The domain within your query sequence starts at position 19 and ends at position 66; the E-value for the ArsA_ATPase domain shown below is 1.7e-8.

HIILVLSGKGGVGKSTISTELALALRHQGKKVGILDVDLCGPSIPHML

ArsA_ATPase

 ArsA_ATPase
PFAM accession number:PF02374
Interpro abstract (IPR025723):

This entry represents a conserved domain, which is sometimes repeated, in an anion-transporting ATPase [ (PUBMED:1704144) (PUBMED:10970874) ]. The ATPase is involved in the removal of arsenate, antimonite, and arsenate from the cell. The entry also matches some sequences from the Mrp/NBP35 ATP-binding proteins family.

This is a PFAM domain. For full annotation and more information, please see the PFAM entry ArsA_ATPase