SMART: Pfam domain Aurora-A

The domain within your query sequence starts at position 1 and ends at position 68; the E-value for the Aurora-A_bind domain shown below is 7.4e-39.

MSQVPTTYSFDAPTDFINFSSLDAEEDTENIDSWFDEKANLENKFLRQRGIGEPFQGKNS
LRKAKLQQ

Aurora-A_bind

PFAM accession number:	PF09041
Interpro abstract (IPR015128):	The Aurora-A binding domain in TPX2 (targeting protein for Xklp2) binds to two distinct sites on the Aurora kinase: the upstream residues bind at the N-terminal lobe, whilst the downstream residues bind in an alpha-helical conformation between the N- and C-terminal lobes. The two Aurora-A binding motifs are connected by a flexible linker that is variable in length and sequence across species. Binding of the domain results strong activation of Aurora-A and protection from deactivating dephosphorylation by phosphatase PP1 [ (PUBMED:14580337) ].

PFAM accession number:

PF09041

Interpro abstract (IPR015128):

The Aurora-A binding domain in TPX2 (targeting protein for Xklp2) binds to two distinct sites on the Aurora kinase: the upstream residues bind at the N-terminal lobe, whilst the downstream residues bind in an alpha-helical conformation between the N- and C-terminal lobes. The two Aurora-A binding motifs are connected by a flexible linker that is variable in length and sequence across species. Binding of the domain results strong activation of Aurora-A and protection from deactivating dephosphorylation by phosphatase PP1 [ (PUBMED:14580337) ].

This is a PFAM domain. For full annotation and more information, please see the PFAM entry Aurora-A_bind