The domain within your query sequence starts at position 36 and ends at position 74; the E-value for the Auto_anti-p27 domain shown below is 2.8e-20.
RLMGDYLLRGYRMLGDTCADCGTILLQDKQRKIYCVACQ
Auto_anti-p27 |
---|
PFAM accession number: | PF06677 |
---|---|
Interpro abstract (IPR009563): | This family consists of several Sjogren's syndrome/scleroderma autoantigen 1 (Autoantigen p27) sequences, also known as ZNRD2. It is thought that the potential association of anti-p27 with anti-centromere antibodies suggests that autoantigen p27 might play a role in mitosis [ (PUBMED:9486406) ]. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry Auto_anti-p27