SMART: Pfam domain Ax_dynein

The domain within your query sequence starts at position 196 and ends at position 380; the E-value for the Ax_dynein_light domain shown below is 3.3e-14.

LLTDSENRLLLFPSMKPNKRVEVVQLSNVMDTMLERAGIENENYVGPTKMHQLLNVLKRE
QSIYNTVFHELIRQVSVDCADRGELLSKIREKYVQMLDHIAQQMIEFYKDLVTQRMMDQR
ILQELYNFKNVIEELTRELCLVQAHDRKLTKEAEKVQKNLAEALLEAEKNAKIVEDYHDL
YTMQR

Ax_dynein_light

PFAM accession number:	PF10211
Interpro abstract (IPR019347):	Axonemal dynein light chain proteins play a dynamic role in flagellar and cilial motility. Eukaryotic cilia and flagella are complex organelles consisting of a core structure, the axoneme, which is composed of nine microtubule doublets forming a cylinder that surrounds a pair of central singlet microtubules. This ultra-structural arrangement seems to be one of the most stable micro-tubular assemblies known and is responsible for the flagellar and ciliary movement of a large number of organisms ranging from protozoan to mammals. This light chain interacts directly with the N-terminal half of the heavy chains [ (PUBMED:11606062) ].

PFAM accession number:

PF10211

Interpro abstract (IPR019347):

Axonemal dynein light chain proteins play a dynamic role in flagellar and cilial motility. Eukaryotic cilia and flagella are complex organelles consisting of a core structure, the axoneme, which is composed of nine microtubule doublets forming a cylinder that surrounds a pair of central singlet microtubules. This ultra-structural arrangement seems to be one of the most stable micro-tubular assemblies known and is responsible for the flagellar and ciliary movement of a large number of organisms ranging from protozoan to mammals. This light chain interacts directly with the N-terminal half of the heavy chains [ (PUBMED:11606062) ].

This is a PFAM domain. For full annotation and more information, please see the PFAM entry Ax_dynein_light