The domain within your query sequence starts at position 432 and ends at position 469; the E-value for the Axin_b-cat_bind domain shown below is 8.6e-22.

EEDPQTILDDHLSRVLKTPGCQSPGVGRYSPRSRSPDH

Axin_b-cat_bind

• PFAM accession number: PF08833
• Interpro abstract (IPR014936):

  Proteins in this entry are found on the scaffolding protein Axin which is a component of the beta-catenin destruction complex. It competes with the tumour suppressor adenomatous polyposis coli protein (APC) for binding to beta-catenin [ (PUBMED:14600025) ].

This is a PFAM domain. For full annotation and more information, please see the PFAM entry Axin_b-cat_bind