The domain within your query sequence starts at position 174 and ends at position 250; the E-value for the B-block_TFIIIC domain shown below is 5.1e-20.
PDFSYCILERLGRSRWQGELQRDLHTTAFKVDAGKLHYHRKILNKNGLITMQSHVIRLPT GAQQHSILLLLNRFHVD
B-block_TFIIIC |
![]() |
---|
PFAM accession number: | PF04182 |
---|---|
Interpro abstract (IPR007309): | Yeast transcription factor IIIC (TFIIIC) is a multisubunit protein complex that interacts with two control elements of class III promoters called the A and B blocks. This family represents the subunit within TFIIIC involved in B-block binding [ (PUBMED:1279682) ]. Although defined as a yeast protein, it is also found in a number of other organisms. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry B-block_TFIIIC