The domain within your query sequence starts at position 4 and ends at position 111; the E-value for the BAMBI domain shown below is 2.4e-66.
HSSYFFIWLQLELCAMAVLLTKGEIRCYCDAAHCVATGYMCKSELSACFSRLLDPQNTNS PLTHGCLDSLASTADICRAKQAQNHSGPAMPTLECCHEDMCNYRGLHD
BAMBI |
---|
PFAM accession number: | PF06211 |
---|---|
Interpro abstract (IPR009345): | This family consists of several eukaryotic BMP and activin membrane-bound inhibitor (BAMBI) proteins. Members of the transforming growth factor-beta (TGF-beta) superfamily, including TGF-beta, bone morphogenetic proteins (BMPs), activins and nodals, are vital for regulating growth and differentiation. BAMBI is related to TGF-beta-family type I receptors but lacks an intracellular kinase domain. BAMBI is an essential regulator of cell proliferation and differentiation that represses transforming growth factor-beta and enhances Wnt/beta-catenin signalling in various cell types [ (PUBMED:26247931) ]. It stably associates with TGF-beta-family receptors and inhibits BMP and activin as well as TGF-beta signalling [ (PUBMED:10519551) ]. |
GO process: | negative regulation of transforming growth factor beta receptor signaling pathway (GO:0030512), positive regulation of canonical Wnt signaling pathway (GO:0090263) |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry BAMBI