The domain within your query sequence starts at position 1 and ends at position 167; the E-value for the BAT2_N domain shown below is 5.6e-73.
MSEKSGQSTKAKDGKKYATLSLFNTYKGKSLETQKTTVAARHGLQSLGKVGISRRMPPPA NLPSLKAENKGNDPNVNIVPKDGTGWASKQEQHEEEKAPEVSPAQPKPGVAAPPEVAPAP KSWASNKQGGQGDGIQVNSQFQQEFPSLQAAGDQEKKEKEANDENYG
BAT2_N |
---|
PFAM accession number: | PF07001 |
---|---|
Interpro abstract (IPR009738): | This entry represents the N terminus (approximately 200 residues) of the proline-rich protein BAT2 (also known as PRRC2A). BAT2 is similar to other proteins with large proline-rich domains, such as some nuclear proteins, collagens, elastin, and synapsin [ (PUBMED:2156268) ]. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry BAT2_N