The domain within your query sequence starts at position 376 and ends at position 416; the E-value for the BDHCT domain shown below is 5.5e-27.
QLIHVMEHICKLVDTVPTDELEALNCGTELLQQRNIRRKLL
BDHCT |
 |
|---|
| PFAM accession number: | PF08072 |
|---|---|
| Interpro abstract (IPR012532): | This is a C-terminal domain in Bloom's syndrome DEAD helicase subfamily [ (PUBMED:15112237) ]. The helicase articipates in DNA replication and repair, exhibiting a magnesium-dependent ATP-dependent DNA-helicase activity that unwinds single- and double-stranded DNA in a 3'-5' direction. |
| GO process: | DNA replication (GO:0006260) |
| GO component: | nucleus (GO:0005634) |
| GO function: | DNA binding (GO:0003677), ATP binding (GO:0005524), hydrolase activity, acting on acid anhydrides, in phosphorus-containing anhydrides (GO:0016818) |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry BDHCT