The domain within your query sequence starts at position 380 and ends at position 419; the E-value for the BDHCT domain shown below is 6.4e-25.
LIHVMEHICKLVDTVPTDELEALNCGTELLQQRNIRRKLL
BDHCT |
![]() |
---|
PFAM accession number: | PF08072 |
---|---|
Interpro abstract (IPR012532): | This is a C-terminal domain in Bloom's syndrome DEAD helicase subfamily [ (PUBMED:15112237) ]. The helicase articipates in DNA replication and repair, exhibiting a magnesium-dependent ATP-dependent DNA-helicase activity that unwinds single- and double-stranded DNA in a 3'-5' direction. |
GO process: | DNA replication (GO:0006260) |
GO component: | nucleus (GO:0005634) |
GO function: | ATP binding (GO:0005524), DNA binding (GO:0003677), hydrolase activity, acting on acid anhydrides, in phosphorus-containing anhydrides (GO:0016818) |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry BDHCT