The domain within your query sequence starts at position 13 and ends at position 204; the E-value for the BNIP3 domain shown below is 5.3e-80.
NNNNNCEEGEQPLPPPAGLNSSWVELPMNSSNGNENGNGKNGGLEHVPSSSSIHNGDMEK ILLDAQHESGQSSSRGSSHCDSPSPQEDGQIMFDVEMHTSRDHSSQSEEEVVEGEKEVEA LKKSADWVSDWSSRPENIPPKEFHFRHPKRAASLSMRKSGAMKKGGIFSAEFLKVFIPSL FLSHVLALGLGW
BNIP3 |
---|
PFAM accession number: | PF06553 |
---|---|
Interpro abstract (IPR010548): | This family consists of several mammalian specific BCL2/adenovirus E1B 19kDa protein-interacting protein 3 or BNIP3 sequences. BNIP3 belongs to the Bcl-2 homology 3 (BH3)-only family, a Bcl-2-related family possessing an atypical Bcl-2 homology 3 (BH3) domain, which regulates PCD from mitochondrial sites by selective Bcl-2/Bcl-XL interactions. BNIP3 family members contain a C-terminal transmembrane domain that is required for their mitochondrial localisation, homodimerisation, as well as regulation of their pro-apoptotic activities. BNIP3-mediated apoptosis has been reported to be independent of caspase activation and cytochrome c release and is characterised by early plasma membrane and mitochondrial damage, prior to the appearance of chromatin condensation or DNA fragmentation [ (PUBMED:12690108) ]. |
GO process: | positive regulation of apoptotic process (GO:0043065) |
GO component: | mitochondrial envelope (GO:0005740), integral component of membrane (GO:0016021) |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry BNIP3