The domain within your query sequence starts at position 665 and ends at position 714; the E-value for the BPL_C domain shown below is 3.7e-12.

HGGQQVRLGSTEGPQASIVGLDDSGFLQVHQEDGGVVTVHPDGNSFDMLR

BPL_C

• PFAM accession number: PF02237
• Interpro abstract (IPR003142):

  This C-terminal domain has an SH3-like barrel fold, the function of which is unknown. It is found associated with prokaryotic bifunctional transcriptional repressors [ (PUBMED:2642476) ] and eukaryotic enzymes involved in biotin utilization [ (PUBMED:7842009) (PUBMED:9173880) ].

  In Escherichia coli the biotin operon repressor (BirA) is a bifunctional protein. BirA acts both as the acetyl-coA carboxylase biotin holoenzyme synthetase ( EC 6.3.4.15 ) and as the biotin operon repressor. DNA sequence analysis of mutations indicates that the helix-turn-helix DNA binding region is located at the N terminus while mutations affecting enzyme function, although mapping over a large region, are found mainly in the central part of the protein's primary sequence [ (PUBMED:2642476) ].

• GO process: cellular protein modification process (GO:0006464)

This is a PFAM domain. For full annotation and more information, please see the PFAM entry BPL_C