SMART: Pfam domain BPS

The domain within your query sequence starts at position 368 and ends at position 415; the E-value for the BPS domain shown below is 3.6e-31.

RSVSDNTLVAMDFSGHAGRVIDNPREALSAAMEEAQAWRKKTNHRLSL

BPS

PFAM accession number:	PF08947
Interpro abstract (IPR015042):	The BPS (Between PH and SH2) domain, comprised of 2 beta strands and a C-terminal helix, is an approximately 45 residue region found in the adaptor proteins Grb7/10/14 that mediates inhibition of the tyrosine kinase domain of the insulin receptor by binding of the N-terminal portion of the BPS domain to the substrate peptide groove of the kinase, acting as a pseudosubstrate inhibitor [ (PUBMED:16246733) ].

PFAM accession number:

PF08947

Interpro abstract (IPR015042):

The BPS (Between PH and SH2) domain, comprised of 2 beta strands and a C-terminal helix, is an approximately 45 residue region found in the adaptor proteins Grb7/10/14 that mediates inhibition of the tyrosine kinase domain of the insulin receptor by binding of the N-terminal portion of the BPS domain to the substrate peptide groove of the kinase, acting as a pseudosubstrate inhibitor [ (PUBMED:16246733) ].

This is a PFAM domain. For full annotation and more information, please see the PFAM entry BPS