SMART: Pfam domain BRCA-2

The domain within your query sequence starts at position 2402 and ends at position 2588; the E-value for the BRCA-2_helical domain shown below is 1.3e-94.

MSSLQSARDLQDMRIKNKERRHLRLQPGSLYLTKSSTLPRISLQAAVGDRAPSACSPKQL
YIYGVSKECINVNSKNAEYFQFDIQDHFGKEDLCAGKGFQLADGGWLIPSNDGKAGKEEF
YRALCDTPGVDPKLISSIWVANHYRWIVWKLAAMEFAFPKEFANRCLNPERVLLQLKYRY
DVEIDNS

BRCA-2_helical

PFAM accession number:	PF09169
Interpro abstract (IPR015252):	This entry represents a domain found in BRCA2 proteins. This domain adopts a helical structure, consisting of a four-helix cluster core (alpha 1, alpha 8, alpha 9, alpha 10) and two successive beta-hairpins (beta 1 to beta 4). An approximately 50-amino acid segment that contains four short helices (alpha 2 to alpha 4), meanders around the surface of the core structure. In BRCA2, the alpha 9 and alpha 10 helices pack with BRCA-2_OB1 ( IPR015187 ) through van der Waals contacts involving hydrophobic and aromatic residues, and also through side-chain and backbone hydrogen bonds. This domain binds the 70-amino acid DSS1 (deleted in split-hand/split foot syndrome) protein, which was originally identified as one of three genes that map to a 1.5-Mb locus deleted in an inherited developmental malformation syndrome [ (PUBMED:12228710) ].

PFAM accession number:

PF09169

Interpro abstract (IPR015252):

This entry represents a domain found in BRCA2 proteins. This domain adopts a helical structure, consisting of a four-helix cluster core (alpha 1, alpha 8, alpha 9, alpha 10) and two successive beta-hairpins (beta 1 to beta 4). An approximately 50-amino acid segment that contains four short helices (alpha 2 to alpha 4), meanders around the surface of the core structure. In BRCA2, the alpha 9 and alpha 10 helices pack with BRCA-2_OB1 ( IPR015187 ) through van der Waals contacts involving hydrophobic and aromatic residues, and also through side-chain and backbone hydrogen bonds. This domain binds the 70-amino acid DSS1 (deleted in split-hand/split foot syndrome) protein, which was originally identified as one of three genes that map to a 1.5-Mb locus deleted in an inherited developmental malformation syndrome [ (PUBMED:12228710) ].

This is a PFAM domain. For full annotation and more information, please see the PFAM entry BRCA-2_helical