The domain within your query sequence starts at position 41 and ends at position 179; the E-value for the BRCT domain shown below is 2e-7.
SKYKPLWGKIFYLDLPSITICEKLQKDIKELGGRVEEFLSKDISYFVSNKKEAKYAQTLG RVSPVPSPESAYTAETTSPHPSHDGSSFKSQDRVCLSRGKLLAEKAVKDHDFIPANSILS NALSWGVKILHIDDIRYYI
BRCT |
---|
PFAM accession number: | PF00533 |
---|---|
Interpro abstract (IPR001357): | The breast cancer susceptibility gene contains at its C terminus two copies of a conserved domain that was named BRCT for BRCA1 C terminus. This domain of about 95 amino acids is found in a large variety of proteins involved in DNA repair, recombination and cell cycle control [ (PUBMED:8673121) (PUBMED:9034168) (PUBMED:9000507) ]. The BRCT domain is not limited to the C-terminal of protein sequences and can be found in multiple copies or in a single copy as in RAP1 and TdT. BRCT domains are often found as tandem-repeat pairs [ (PUBMED:15501676) ]. Some data [ (PUBMED:9799248) ] indicate that the BRCT domain functions as a protein-protein interaction module. The structure of the first of the two C-terminal BRCT domains of the human DNA repair protein XRCC1 has recently been determined by X-ray crystallography [ (PUBMED:9799248) ]. Structures of the BRCA1 BRCT domains revealed a basis for a widely utilised head-to-tail BRCT-BRCT oligomerisation mode [ (PUBMED:11573086) ]. This conserved tandem BRCT architecture facilitates formation of the canonical BRCT phospho-peptide interaction cleft at a groove between the BRCT domains. BRCT domains disrupt peptide binding by directly occluding this peptide binding groove, or by disrupting key conserved BRCT core folding determinants [ (PUBMED:15133503) ]. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry BRCT