The domain within your query sequence starts at position 1 and ends at position 219; the E-value for the Bap31 domain shown below is 9.2e-62.
MTIQWAAVASFLYAEIGLILLFCLPFIPPQRWQKIFSFSVWGKIASFWNKAFLTIIILLI ILFLDAVREVRKYSSTNVVEKNSAIRPSAFEHTQMKLFRSQRNLYISGFSLFFWLVLRRL VTLITQLAKEIANKGVLKIQAENTNKAAKKFMEENEKLKLGLRNDNAEEHLLEAENKKLI ESKENLKTELKKASDALLKAQNDVMTMKIQSERLSKEYD
Bap31 |
---|
PFAM accession number: | PF05529 |
---|---|
Interpro abstract (IPR040463): | The mammalian B-cell receptor-associated proteins of 29 and 31kDa (BAP29 and BAP31) are integral membrane proteins with a role in endoplasmic reticulum (ER) quality control and sorting [ (PUBMED:9396746) (PUBMED:17056546) (PUBMED:15187134) ]. BAP31 is also involved in apoptosis [ (PUBMED:21183955) ]. Saccharomyces cerevisiae possesses three homologues of BAP31 known as Yet1, Yet2, and Yet3 [ (PUBMED:20378542) ]. These proteins are predicted to have three transmembrane segments with a cytoplasmic, coiled-coil C-terminal domain [ (PUBMED:20378542) ]. This entry represents the transmembrane region. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry Bap31