SMART: Pfam domain Bax1-I

The domain within your query sequence starts at position 24 and ends at position 225; the E-value for the Bax1-I domain shown below is 3.6e-42.

QQHLKKVYASFALCMFVAAAGAYVHVVTHFIQAGLLSALGSLALMIWLMATPHSHETEQK
RLGLLAGFAFLTGVGLGPALELCIAVNPSILPTAFMGTAMIFTCFSLSALYARRRSYLFL
GGILMSAMSLMLLSSLGNLFFGSIWLFQANLYLGLLVMCGFVLFDTQLIIEKAEHGDKDY
IWHCVDLFLDFVTLFRKLMLIL

Bax1-I

PFAM accession number:	PF01027
Interpro abstract (IPR006214):	Bax inhibitor-1 (BI-1) [ (PUBMED:8530040) ] is a suppressor of apoptosis that interacts with BCL2 and BCL-X. Human Bax BI-1 is an evolutionarily conserved integral membrane protein containing multiple membrane-spanning segments predominantly localised to intracellular membranes. It has 6-7 membrane-spanning domains. The C termini of the mammalian BI-1 proteins are comprised of basic amino acids resembling some nuclear targeting sequences, but otherwise the predicted proteins lack motifs that suggest this function. As plant BI-1 appears to localise predominantly to the ER, it was suggested that plant BI-1 could also regulate cell death triggered by ER stress [ (PUBMED:19704470) ]. BI-1 appears to exert its effect through an interaction with calmodulin [ (PUBMED:19742129) ]. This entry represents BI-1 and related sequences, including lifeguard proteins, which also act as apoptotic regulators.

PFAM accession number:

PF01027

Interpro abstract (IPR006214):

Bax inhibitor-1 (BI-1) [ (PUBMED:8530040) ] is a suppressor of apoptosis that interacts with BCL2 and BCL-X. Human Bax BI-1 is an evolutionarily conserved integral membrane protein containing multiple membrane-spanning segments predominantly localised to intracellular membranes. It has 6-7 membrane-spanning domains. The C termini of the mammalian BI-1 proteins are comprised of basic amino acids resembling some nuclear targeting sequences, but otherwise the predicted proteins lack motifs that suggest this function. As plant BI-1 appears to localise predominantly to the ER, it was suggested that plant BI-1 could also regulate cell death triggered by ER stress [ (PUBMED:19704470) ]. BI-1 appears to exert its effect through an interaction with calmodulin [ (PUBMED:19742129) ].

This entry represents BI-1 and related sequences, including lifeguard proteins, which also act as apoptotic regulators.

This is a PFAM domain. For full annotation and more information, please see the PFAM entry Bax1-I