The domain within your query sequence starts at position 1 and ends at position 94; the E-value for the BaxI_1 domain shown below is 7.1e-16.
MLAARLVCLRTLPSRVFQPTFITKASPLVKNSITKNQWLVTPSREYATKTRIRTHRGKTG QELKEAALEPSMEKIFKIDQMGRWFVAGGAAVGL
BaxI_1 |
---|
PFAM accession number: | PF12811 |
---|---|
Interpro abstract (IPR010539): | The function of UCP009160 is not clear. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry BaxI_1