The domain within your query sequence starts at position 90 and ends at position 187; the E-value for the BaxI_1 domain shown below is 1.8e-17.
AAVGLGALCYYGLGMSNEIGAIEKAVIWPQYVKDRIHSTYMYLAGSIGLTALSALAVART PALMNFMMTGSWVTIGATFAAMIGAGMLVHSISYEQSP
BaxI_1 |
![]() |
---|
PFAM accession number: | PF12811 |
---|---|
Interpro abstract (IPR010539): | The function of UCP009160 is not clear. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry BaxI_1