The domain within your query sequence starts at position 132 and ends at position 244; the E-value for the Biliv-reduc_cat domain shown below is 2.6e-55.
FEFLKREVAGKELLKGSLRFTASPLEEEKFGFPAFSGISRLTWLVSLFGELSLISATMEN RKEDQYMKMTVQLETQNKSPLSWIEEKGPGLKRNRHISIHFKSGSLEEVPNVG
Biliv-reduc_cat |
 |
|---|
| PFAM accession number: | PF09166 |
|---|---|
| Interpro abstract (IPR015249): | This entry represents the biliverdin reductase, catalytic domain, which adopts a structure ccontaining a six-stranded beta-sheet that is flanked on one face by several alpha-helices. This domain contains the catalytic active site which reduces the gamma-methene bridge of the open tetrapyrrole, biliverdin IX alpha, to bilirubin with the concomitant oxidation of a NADH or NADPH cofactor [ (PUBMED:12079357) ]. |
| GO process: | oxidation-reduction process (GO:0055114), heme catabolic process (GO:0042167) |
| GO function: | biliverdin reductase (NAD(P)+) activity (GO:0004074), zinc ion binding (GO:0008270) |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry Biliv-reduc_cat