The domain within your query sequence starts at position 552 and ends at position 660; the E-value for the Bin3 domain shown below is 4.2e-45.
YDVVLCFSLTKWVHLNWGDEGLKRMFRRIYRHLRPGGILVLEPQPWSSYCKRKSLTETIY KNYFRIQLKPEQFSSYLTSPEVGFSSYELVATPNNTSRGFQRPVYLFHK
Bin3 |
![]() |
---|
PFAM accession number: | PF06859 |
---|---|
Interpro abstract (IPR010675): | This entry represents the C-terminal conserved region of the Drosophila probable RNA methyltransferase bin3 [ (PUBMED:1071748) ]. Proteins containing this domain also include human pre-miRNA 5'-monophosphate methyltransferase BCDIN3D [ (PUBMED:23063121) ] and 7SK snRNA methylphosphate capping enzyme MEPCE [ (PUBMED:17643375) ]. This domain contains a conserved HLN motif. |
GO function: | methyltransferase activity (GO:0008168) |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry Bin3