The domain within your query sequence starts at position 1 and ends at position 153; the E-value for the BioT2 domain shown below is 1.3e-64.
MKRAKHPSNISVKLTSVPELPYNKGLLNSSPKPKEKHNAKSTPDKIEPMVIRSPPTGESI VRYALPIPSTMMKDLVSDAEMVRRIATNMKMLVTNLEETYGVCYDDEEKEAEKSEAEGFS VGDDVSSFLLCCSQFAAQLEEAVKEEYNLRRAT
BioT2 |
![]() |
---|
PFAM accession number: | PF15368 |
---|---|
Interpro abstract (IPR029272): | This entry represents the coiled-coil domain-containing protein 7 (also known as BioT2), which is a testis-specific protein found abundantly in five types of murine cancer cell lines. It may play a role in testis development and tumourigenesis [ (PUBMED:1927747) (PUBMED:19447332) (PUBMED:20704574) ]. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry BioT2