The domain within your query sequence starts at position 12 and ends at position 79; the E-value for the BolA domain shown below is 1.2e-23.

LRQDLEAEHVEVEDTTLNRCATSFRVLVVSAKFEGKPLLQRHRLVNECLAEELPHIHAFE
QKTLTPEQ

BolA

BolA
PFAM accession number:PF01722
Interpro abstract (IPR002634):

This family consist of the morpho-protein BolA from Escherichia coli and its various homologues. In E. coli, over-expression of this protein causes round morphology and may be involved in switching the cell between elongation and septation systems during cell division [ (PUBMED:10361282) ]. The expression of BolA is growth rate regulated and is induced during the transition into the the stationary phase [ (PUBMED:10361282) ]. BolA is also induced by stress during early stages of growth [ (PUBMED:10361282) ] and may have a general role in stress response. It has also been suggested that BolA can induce the transcription of penicillin binding proteins 6 and 5 [ (PUBMED:2684651) (PUBMED:10361282) ]. IbaG is a BolA homologue involved in acid resistance [ (PUBMED:22534295) ].

This is a PFAM domain. For full annotation and more information, please see the PFAM entry BolA