The domain within your query sequence starts at position 148 and ends at position 286; the E-value for the Borealin domain shown below is 5.9e-27.
RSAKVKRCLPSKKRTQSIQGRGRSKRLSHDFVTPAMSRLEPSLVKPTPGMTPRFDSRVFK TPGLRTPAAKEQVYNISINGSPLADSKEISLSVPIGGGASLRLLASDLQRIDIAQLNPEA LGNIRKLSGRVILQHLCAS
Borealin |
![]() |
---|
PFAM accession number: | PF10512 |
---|---|
Interpro abstract (IPR018867): | The chromosomal passenger complex of Aurora B kinase, INCENP, and Survivin has essential regulatory roles at centromeres and the central spindle in mitosis. Cell division cycle-associated protein 8, also known as Borealin, is also a member of the complex. Approximately half of Aurora B in mitotic cells is complexed with INCENP, Borealin, and Survivin. Depletion of Borealin by RNA interference delays mitotic progression and results in kinetochore-spindle mis-attachments and an increase in bipolar spindles associated with ectopic asters [ (PUBMED:15249581) ]. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry Borealin